OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PALS1 (NM_022474) Human Mass Spec Standard

Be the first to review this product
SKU
PH324752
MPP5 MS Standard C13 and N15-labeled recombinant protein (NP_071919)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504451 MPP5 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3) 100 ul
$447.00
LY411659 Transient overexpression lysate of membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) (MPP5) (as WB positive control) 100 ug
$436.00

Other products for "MPP5 or NM_022474"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224752
Predicted MW 77.3 kDa
Protein Sequence
Protein Sequence
>RC224752 protein sequence
Red=Cloning site Green=Tags(s)

MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRR
EEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVD
SQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTA
LLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVII
SRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHV
KAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNC
GQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSI
DSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTRE
MEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071919
RefSeq Size 5608
RefSeq ORF 2025
Synonyms PALS1
Locus ID 64398
UniProt ID Q8N3R9
Cytogenetics 14q23.3
Summary This gene encodes a member of the p55-like subfamily of the membrane-associated guanylate kinase (MAGUK) gene superfamily. The encoded protein participates in the polarization of differentiating cells, has been shown to regulate myelinating Schwann cells (PMID: 20237282), and is one of the components of the Crumbs complex in the retina. Mice which express lower levels of the orthologous protein have retinal degeneration and impaired vision (PMID: 22114289). Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Feb 2012
Protein Families Druggable Genome
Protein Pathways Tight junction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MPP5" proteins (3)
SKU Description Size Price
LC411659 Lyophilized MPP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411659 Transient overexpression lysate of membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) (MPP5) (as WB positive control) 100 ug
$436.00
TP324752 Recombinant protein of human membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) (MPP5), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products