OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRRG2 (NM_000951) Human Mass Spec Standard

Be the first to review this product
SKU
PH324364
PRRG2 MS Standard C13 and N15-labeled recombinant protein (NP_000942)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335272 Rabbit Polyclonal Anti-PRRG2 Antibody
100 ul
$585.00
LY424446 Transient overexpression lysate of proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2) (as WB positive control) 100 ug
$436.00

Other products for "PRRG2 or NM_000951"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224364
Predicted MW 22.2 kDa
Protein Sequence
Protein Sequence
>RC224364 representing NM_000951
Red=Cloning site Green=Tags(s)

MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTPGNLERECLEE
RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILLIVLAGLGAFWYLRWRQHRGQ
QPCPQEAGLISPLSPLNPLGPPTPLPPPPPPPPGLPTYEQALAASGVHDAPPPPYTSLRRPH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000942
RefSeq Size 1167
RefSeq ORF 606
Synonyms PRGP2
Locus ID 5639
UniProt ID O14669
Cytogenetics 19q13.33
Summary The protein encoded by this gene is a single-pass transmembrane protein containing an N-terminal gamma-carboxyglutamic acid (Gla) domain and tandem Pro/Leu-Pro-Xaa-Tyr (PY) motifs at its C-terminal end. The Gla domain is exposed on the cell surface while the PY motifs are cytoplasmic. The PY motifs of the encoded protein have been shown to interact with YAP1, a WW domain-containing protein. Therefore, it is thought that the encoded protein may be part of a signal transduction pathway. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2015
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRRG2" proteins (4)
SKU Description Size Price
LC424446 Lyophilized PRRG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424446 Transient overexpression lysate of proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2) (as WB positive control) 100 ug
$436.00
TP324364 Recombinant protein of human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), 20 µg 20 ug
$737.00
TP761765 Purified recombinant protein of Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), full length, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products