PRRG2 (NM_000951) Human Tagged ORF Clone

SKU
RC224364
PRRG2 (Myc-DDK-tagged)-Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PRRG2
Synonyms PRGP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224364 representing NM_000951
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGGCCACCCCTCTCTGCTGCTGCTATATATGGCATTAACCACCTGCCTGGATACTTCACCCAGTG
AGGAGACAGACCAAGAAGTCTTCCTGGGTCCCCCAGAGGCCCAGAGCTTCCTGAGTAGCCATACCCGGAT
TCCAAGAGCCAACCACTGGGACCTGGAGCTGCTCACACCAGGGAACCTGGAACGGGAGTGTCTGGAAGAG
AGGTGTTCCTGGGAAGAGGCCAGGGAGTATTTTGAGGACAACACTCTCACGGAGCGCTTTTGGGAGAGCT
ACATCTACAATGGCAAAGGAGGGCGTGGACGAGTGGATGTGGCCAGCCTGGCTGTGGGGCTGACAGGTGG
CATCCTGCTCATTGTCCTGGCCGGCCTGGGAGCCTTTTGGTATCTGCGCTGGCGACAGCACCGAGGCCAG
CAGCCCTGTCCCCAAGAGGCCGGGCTCATTAGCCCTCTGAGTCCTTTGAACCCTCTGGGCCCACCGACGC
CCCTGCCTCCACCCCCACCCCCACCCCCAGGCCTCCCCACCTATGAGCAGGCGCTGGCAGCCTCTGGGGT
ACACGACGCACCTCCACCCCCCTACACCAGCCTCAGGAGGCCTCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224364 representing NM_000951
Red=Cloning site Green=Tags(s)

MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTPGNLERECLEE
RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILLIVLAGLGAFWYLRWRQHRGQ
QPCPQEAGLISPLSPLNPLGPPTPLPPPPPPPPGLPTYEQALAASGVHDAPPPPYTSLRRPH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000951
ORF Size 606 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000951.3
RefSeq Size 1167 bp
RefSeq ORF 609 bp
Locus ID 5639
UniProt ID O14669
Cytogenetics 19q13.33
Protein Families Transmembrane
MW 22.2 kDa
Summary The protein encoded by this gene is a single-pass transmembrane protein containing an N-terminal gamma-carboxyglutamic acid (Gla) domain and tandem Pro/Leu-Pro-Xaa-Tyr (PY) motifs at its C-terminal end. The Gla domain is exposed on the cell surface while the PY motifs are cytoplasmic. The PY motifs of the encoded protein have been shown to interact with YAP1, a WW domain-containing protein. Therefore, it is thought that the encoded protein may be part of a signal transduction pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:PRRG2 (NM_000951) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224364L1 Lenti ORF clone of Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), Myc-DDK-tagged 10 ug
$600.00
RC224364L2 Lenti ORF clone of Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), mGFP tagged 10 ug
$600.00
RC224364L3 Lenti ORF clone of Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), Myc-DDK-tagged 10 ug
$600.00
RC224364L4 Lenti ORF clone of Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), mGFP tagged 10 ug
$600.00
RG224364 PRRG2 (tGFP-tagged) - Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC300158 PRRG2 (untagged)-Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.