OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PQBP1 (NM_001032382) Human Mass Spec Standard

Be the first to review this product
SKU
PH323994
PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027554)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329292 Rabbit Polyclonal anti-PQBP1 antibody
100 ul
$525.00
LY417119 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PQBP1 or NM_001032382"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223994
Predicted MW 30.5 kDa
Protein Sequence
Protein Sequence
>RC223994 protein sequence
Red=Cloning site Green=Tags(s)

MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADT
DLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDR
DRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYS
DAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001027554
RefSeq Size 1082
RefSeq ORF 795
Synonyms MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS
Locus ID 10084
UniProt ID O60828
Cytogenetics Xp11.23
Summary This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.provided by RefSeq, Nov 2009
Protein Families Transcription Factors
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PQBP1" proteins (22)
SKU Description Size Price
PH304269 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027553) 10 ug
$3,360.00
PH321161 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027556) 10 ug
$3,360.00
PH323943 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_005701) 10 ug
$3,360.00
PH324043 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555) 10 ug
$3,360.00
LC417119 Lyophilized PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422317 Lyophilized PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422318 Lyophilized PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422319 Lyophilized PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422320 Lyophilized PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432617 Lyophilized PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417119 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422317 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422318 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY422319 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY422320 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY432617 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 10 (as WB positive control) 100 ug
$436.00
TP304269 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 2, 20 µg 20 ug
$737.00
TP321161 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 5, 20 µg 20 ug
$737.00
TP323943 Recombinant protein of human polyglutamine binding protein 1 (PQBP1), transcript variant 1, 20 µg 20 ug
$737.00
TP323994 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 3, 20 µg 20 ug
$737.00
TP324043 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 4, 20 µg 20 ug
$737.00
TP329617 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 10, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products