PQBP1 (NM_001032381) Human Recombinant Protein

SKU
TP304269
Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204269 protein sequence
Red=Cloning site Green=Tags(s)

MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADT
DLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDR
DRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYS
DAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001027553
Locus ID 10084
UniProt ID O60828
Cytogenetics Xp11.23
RefSeq Size 1014
RefSeq ORF 795
Synonyms MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS
Summary This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.[provided by RefSeq, Nov 2009]
Protein Families Transcription Factors
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:PQBP1 (NM_001032381) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304269 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027553) 10 ug
$3,255.00
PH321161 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027556) 10 ug
$3,255.00
PH323943 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_005701) 10 ug
$3,255.00
PH323994 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027554) 10 ug
$3,255.00
PH324043 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555) 10 ug
$3,255.00
LC417119 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422317 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422318 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422319 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422320 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432617 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417119 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 1 100 ug
$436.00
LY422317 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 2 100 ug
$436.00
LY422318 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 3 100 ug
$436.00
LY422319 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 4 100 ug
$436.00
LY422320 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 5 100 ug
$436.00
LY432617 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 10 100 ug
$436.00
TP321161 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 5, 20 µg 20 ug
$737.00
TP323943 Recombinant protein of human polyglutamine binding protein 1 (PQBP1), transcript variant 1, 20 µg 20 ug
$737.00
TP323994 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 3, 20 µg 20 ug
$737.00
TP324043 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 4, 20 µg 20 ug
$737.00
TP329617 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 10, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.