PQBP1 (NM_005710) Human Mass Spec Standard

SKU
PH323943
PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_005701)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223943]
Predicted MW 30.5 kDa
Protein Sequence
Protein Sequence
>RC223943 protein sequence
Red=Cloning site Green=Tags(s)

MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADT
DLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDR
DRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYS
DAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005701
RefSeq Size 1147
RefSeq ORF 795
Synonyms MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS
Locus ID 10084
UniProt ID O60828
Cytogenetics Xp11.23
Summary This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.[provided by RefSeq, Nov 2009]
Protein Families Transcription Factors
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:PQBP1 (NM_005710) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304269 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027553) 10 ug
$3,255.00
PH321161 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027556) 10 ug
$3,255.00
PH323994 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027554) 10 ug
$3,255.00
PH324043 PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555) 10 ug
$3,255.00
LC417119 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422317 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422318 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422319 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422320 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432617 PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417119 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 1 100 ug
$436.00
LY422317 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 2 100 ug
$436.00
LY422318 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 3 100 ug
$436.00
LY422319 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 4 100 ug
$436.00
LY422320 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 5 100 ug
$436.00
LY432617 Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 10 100 ug
$436.00
TP304269 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 2, 20 µg 20 ug
$737.00
TP321161 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 5, 20 µg 20 ug
$737.00
TP323943 Recombinant protein of human polyglutamine binding protein 1 (PQBP1), transcript variant 1, 20 µg 20 ug
$737.00
TP323994 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 3, 20 µg 20 ug
$737.00
TP324043 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 4, 20 µg 20 ug
$737.00
TP329617 Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 10, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.