GAS2 (NM_005256) Human Mass Spec Standard

CAT#: PH323624

GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005247)

Product Images

Coomassie blue staining of purified GAS2 protein (Cat# TP323624). The protein was produced from HEK293T cells transfected with GAS2 cDNA clone (Cat# RC223624) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223624
• Predicted MW: 34.9 kDa
• Protein Sequence:
  Sequence Link

  >RC223624 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL
  AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK
  QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS
  EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK
  TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005247
• RefSeq Size: 2031
• RefSeq ORF: 939
• Synonyms: GAS-2
• Locus ID: 2620
• UniProt ID: O43903
• Cytogenetics: 11p14.3
• Summary: The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2017]
• Protein Families: Druggable Genome