GAS2 (NM_177553) Human Mass Spec Standard

SKU
PH305912
GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_808221)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205912]
Predicted MW 34.9 kDa
Protein Sequence
Protein Sequence
>RC205912 protein sequence
Red=Cloning site Green=Tags(s)

MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL
AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK
QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS
EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK
TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_808221
RefSeq Size 2182
RefSeq ORF 939
Synonyms GAS-2
Locus ID 2620
UniProt ID O43903
Cytogenetics 11p14.3
Summary The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2017]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:GAS2 (NM_177553) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323624 GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005247) 10 ug
$3,255.00
PH326863 GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137302) 10 ug
$3,255.00
LC406084 GAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417420 GAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428373 GAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406084 Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 2 100 ug
$436.00
LY417420 Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 1 100 ug
$436.00
LY428373 Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 3 100 ug
$436.00
TP305912 Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323624 Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326863 Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.