OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAS2 (NM_005256) Human Mass Spec Standard

Be the first to review this product
SKU
PH323624
GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005247)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349325 Rabbit Polyclonal Anti-GAS2 Antibody
100 ul
$205.00
LY406084 Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "GAS2 or NM_005256"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223624
Predicted MW 34.9 kDa
Protein Sequence
Protein Sequence
>RC223624 protein sequence
Red=Cloning site Green=Tags(s)

MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL
AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK
QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS
EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK
TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005247
RefSeq Size 2031
RefSeq ORF 939
Synonyms GAS-2
Locus ID 2620
UniProt ID O43903
Cytogenetics 11p14.3
Summary The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants. provided by RefSeq, May 2017
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAS2" proteins (11)
SKU Description Size Price
PH305912 GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_808221) 10 ug
$3,360.00
PH326863 GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137302) 10 ug
$3,360.00
LC406084 Lyophilized GAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417420 Lyophilized GAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428373 Lyophilized GAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406084 Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY417420 Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428373 Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305912 Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 2, 20 µg 20 ug
$867.00
TP323624 Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 1, 20 µg 20 ug
$867.00
TP326863 Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products