GPLD1 (NM_177483) Human Mass Spec Standard

CAT#: PH323455

GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_803436)

Product Images

Coomassie blue staining of purified GPLD1 protein (Cat# TP323455). The protein was produced from HEK293T cells transfected with GPLD1 cDNA clone (Cat# RC223455) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223455
• Predicted MW: 17.3 kDa
• Protein Sequence:
  Sequence Link

  >RC223455 representing NM_177483
  Red=Cloning site Green=Tags(s)
  
  MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF
  YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG
  FLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_803436
• RefSeq Size: 1096
• RefSeq ORF: 528
• Synonyms: GPIPLD; GPIPLDM; MGC22590; PIGPLD; PIGPLD1
• Locus ID: 2822
• UniProt ID: P80108
• Cytogenetics: 6p22.3
• Summary: Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Glycosylphosphatidylinositol(GPI)-anchor biosynthesis