GPLD1 (NM_177483) Human Tagged ORF Clone

SKU
RC223455
GPLD1 (Myc-DDK-tagged)-Human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GPLD1
Synonyms GPIPLD; GPIPLDM; MGC22590; PIGPLD; PIGPLD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223455 representing NM_177483
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGCTTTCAGGTTGTGGCCTGGCCTGCTGATCATGTTGGGTTCTCTCTGCCATAGAGGTTCACCGT
GTGGCCTTTCAACACACGTAGAAATAGGACACAGAGCTCTGGAGTTTCTTCAGCTTCACAATGGGCGTGT
TAACTACAGAGAGCTGTTACTAGAACACCAGGATGCGTATCAGGCTGGAATCGTGTTTCCTGATTGTTTT
TACCCTAGCATCTGCAAAGGAGGAAAATTCCATGATGTGTCTGAGAGCACTCACTGGACTCCGTTTCTTA
ATGCAAGCGTTCATTATATCCGAGAGAACTATCCCCTTCCCTGGGAGAAGGACACAGAGAAACTGGTAGC
TTTCTTGTTTGGAATTACTTCTCACATGGCGGCAGATGTCAGCTGGCATAGTCTGGGCCTTGAACAAGGA
TTCCTTAGGACCATGGGAGCTATTGATTTTCACGGCTCCTATTCAGAGGCTCATTCGGCTGGTGATTTTG
GTACTGTTTATTTACATTTGCTAAATTTTCTCGTGGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223455 representing NM_177483
Red=Cloning site Green=Tags(s)

MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF
YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG
FLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_177483
ORF Size 528 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177483.1, NP_803436.1
RefSeq Size 1096 bp
RefSeq ORF 530 bp
Locus ID 2822
Cytogenetics 6p22.3
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
MW 17.3 kDa
Summary Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GPLD1 (NM_177483) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223455L1 Lenti ORF clone of Human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC223455L2 Lenti ORF clone of Human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2, mGFP tagged 10 ug
$600.00
RC223455L3 Lenti ORF clone of Human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC223455L4 Lenti ORF clone of Human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2, mGFP tagged 10 ug
$600.00
RG223455 GPLD1 (tGFP-tagged) - Human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2 10 ug
$500.00
SC307100 GPLD1 (untagged)-Human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.