OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UGT2B10 (NM_001075) Human Mass Spec Standard

Be the first to review this product
SKU
PH323408
UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001066)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA383078 UGT2B10 Rabbit polyclonal Antibody
100 ul
$410.00
LY421349 Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "UGT2B10 or NM_001075"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223408
Predicted MW 60.6 kDa
Protein Sequence
Protein Sequence
>RC223408 representing NM_001075
Red=Cloning site Green=Tags(s)

MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSST
LKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQ
ESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERV
KNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLH
CKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNT
RLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMS
STDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSL
DVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001066
RefSeq Size 1620
RefSeq ORF 1584
Synonyms UDPGT2B10
Locus ID 7365
UniProt ID P36537
Cytogenetics 4q13.2
Summary UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Protein Pathways Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UGT2B10" proteins (7)
SKU Description Size Price
PH327991 UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001138239) 10 ug
$3,360.00
LC421349 Lyophilized UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428511 Lyophilized UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421349 Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY428511 Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP323408 Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1, 20 µg 20 ug
$867.00
TP327991 Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products