UGT2B10 (NM_001144767) Human Mass Spec Standard

SKU
PH327991
UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001138239)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227991]
Predicted MW 50.5 kDa
Protein Sequence
Protein Sequence
>RC227991 representing NM_001144767
Red=Cloning site Green=Tags(s)

MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSST
LKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQ
ESRFDIVFADAYLPCGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEF
VQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGH
PKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVIND
PSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVL
FIITKCCLFCFWKFARKGKKGKRD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138239
RefSeq ORF 1332
Synonyms UDPGT2B10
Locus ID 7365
UniProt ID P36537
Cytogenetics 4q13.2
Summary UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Protein Pathways Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism
Write Your Own Review
You're reviewing:UGT2B10 (NM_001144767) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323408 UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001066) 10 ug
$3,255.00
LC421349 UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428511 UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421349 Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1 100 ug
$665.00
LY428511 Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2 100 ug
$436.00
TP323408 Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1, 20 µg 20 ug
$867.00
TP327991 Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.