UGT2B10 (NM_001144767) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC227991] |
Predicted MW | 50.5 kDa |
Protein Sequence |
Protein Sequence
>RC227991 representing NM_001144767
Red=Cloning site Green=Tags(s) MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSST LKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQ ESRFDIVFADAYLPCGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEF VQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGH PKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVIND PSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVL FIITKCCLFCFWKFARKGKKGKRD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001138239 |
RefSeq ORF | 1332 |
Synonyms | UDPGT2B10 |
Locus ID | 7365 |
UniProt ID | P36537 |
Cytogenetics | 4q13.2 |
Summary | UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH323408 | UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001066) | 10 ug |
$3,255.00
|
|
LC421349 | UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC428511 | UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY421349 | Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1 | 100 ug |
$665.00
|
|
LY428511 | Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2 | 100 ug |
$436.00
|
|
TP323408 | Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP327991 | Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.