OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MBNL1 (NM_207293) Human Mass Spec Standard

Be the first to review this product
SKU
PH323104
MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997176)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344054 Rabbit Polyclonal Anti-MBNL1 Antibody
100 ul
$585.00
LY404079 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 6 (as WB positive control) 100 ug
$436.00

Other products for "MBNL1 or NM_207293"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223104
Predicted MW 41.6 kDa
Protein Sequence
Protein Sequence
>RC223104 representing NM_207293
Red=Cloning site Green=Tags(s)

MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLH
PPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPV
SPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTM
IDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRP
LEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATV
SAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997176
RefSeq Size 5390
RefSeq ORF 1164
Synonyms EXP; MBNL
Locus ID 4154
UniProt ID Q9NR56
Cytogenetics 3q25.1-q25.2
Summary This gene encodes a member of the muscleblind protein family which was initially described in Drosophila melanogaster. The encoded protein is a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Mice lacking this gene exhibited muscle abnormalities and cataracts. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. The different isoforms are thought to have different binding specificities and/or splicing activities. provided by RefSeq, Sep 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MBNL1" proteins (23)
SKU Description Size Price
PH308112 MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_066368) 10 ug
$3,360.00
PH319704 MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997178) 10 ug
$3,360.00
PH323199 MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997180) 10 ug
$3,360.00
PH323216 MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997179) 10 ug
$3,360.00
LC402822 Lyophilized MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404075 Lyophilized MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404076 Lyophilized MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404077 Lyophilized MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404078 Lyophilized MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404079 Lyophilized MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404080 Lyophilized MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402822 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404075 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404076 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY404077 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY404078 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY404079 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY404080 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 7 (as WB positive control) 100 ug
$436.00
TP308112 Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 1, 20 µg 20 ug
$737.00
TP319704 Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 5, 20 µg 20 ug
$737.00
TP323104 Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 3, 20 µg 20 ug
$737.00
TP323199 Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 7, 20 µg 20 ug
$737.00
TP323216 Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 6, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products