MBNL1 (NM_021038) Human Mass Spec Standard

SKU
PH308112
MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_066368)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208112]
Predicted MW 41 kDa
Protein Sequence
Protein Sequence
>RC208112 protein sequence
Red=Cloning site Green=Tags(s)

MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLH
PPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPV
SPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTM
IDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLP
KRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTS
ATSVPFAATATANQIPIISAEHLTSHKYVTQM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066368
RefSeq Size 6404
RefSeq ORF 1146
Synonyms EXP; MBNL
Locus ID 4154
UniProt ID Q9NR56
Cytogenetics 3q25.1-q25.2
Summary This gene encodes a member of the muscleblind protein family which was initially described in Drosophila melanogaster. The encoded protein is a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Mice lacking this gene exhibited muscle abnormalities and cataracts. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. The different isoforms are thought to have different binding specificities and/or splicing activities. [provided by RefSeq, Sep 2015]
Write Your Own Review
You're reviewing:MBNL1 (NM_021038) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319704 MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997178) 10 ug
$3,255.00
PH323104 MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997176) 10 ug
$3,255.00
PH323199 MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997180) 10 ug
$3,255.00
PH323216 MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997179) 10 ug
$3,255.00
LC402822 MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404075 MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404076 MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404077 MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404078 MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404079 MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404080 MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402822 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 1 100 ug
$436.00
LY404075 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 2 100 ug
$436.00
LY404076 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 3 100 ug
$436.00
LY404077 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 4 100 ug
$436.00
LY404078 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 5 100 ug
$436.00
LY404079 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 6 100 ug
$436.00
LY404080 Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 7 100 ug
$436.00
TP308112 Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 1, 20 µg 20 ug
$737.00
TP319704 Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 5, 20 µg 20 ug
$737.00
TP323104 Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 3, 20 µg 20 ug
$737.00
TP323199 Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 7, 20 µg 20 ug
$737.00
TP323216 Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 6, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.