OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL5RA (NM_175727) Human Mass Spec Standard

Be the first to review this product
SKU
PH322553
IL5RA MS Standard C13 and N15-labeled recombinant protein (NP_783854)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351287 Rabbit Polyclonal Anti-IL5RA Antibody
100 ul
$205.00
LY403576 Transient overexpression lysate of interleukin 5 receptor, alpha (IL5RA), transcript variant 6 (as WB positive control) 100 ug
$436.00

Other products for "IL5RA or NM_175727"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222553
Predicted MW 37.5 kDa
Protein Sequence
Protein Sequence
>RC222553 representing NM_175727
Red=Cloning site Green=Tags(s)

MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKIN
APKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTE
DNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDW
LAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTR
NGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_783854
RefSeq Size 1956
RefSeq ORF 999
Synonyms CD125; CDw125; HSIL5R3; IL5R
Locus ID 3568
UniProt ID Q01344
Cytogenetics 3p26.2
Summary The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported. provided by RefSeq, Jul 2011
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IL5RA" proteins (12)
SKU Description Size Price
PH305386 IL5RA MS Standard C13 and N15-labeled recombinant protein (NP_783852) 10 ug
$3,360.00
LC403576 Lyophilized IL5RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406266 Lyophilized IL5RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406268 Lyophilized IL5RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424642 Lyophilized IL5RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403576 Transient overexpression lysate of interleukin 5 receptor, alpha (IL5RA), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY406266 Transient overexpression lysate of interleukin 5 receptor, alpha (IL5RA), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY406268 Transient overexpression lysate of interleukin 5 receptor, alpha (IL5RA), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY424642 Transient overexpression lysate of interleukin 5 receptor, alpha (IL5RA), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP305386 Recombinant protein of human interleukin 5 receptor, alpha (IL5RA), transcript variant 3, 20 µg 20 ug
$737.00
TP322553 Purified recombinant protein of Homo sapiens interleukin 5 receptor, alpha (IL5RA), transcript variant 5, 20 µg 20 ug
$737.00
TP723993 Recombinant human L5RA protein with C-terminal 6×His tag 100 ug
$770.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products