OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ATG9A (NM_024085) Human Mass Spec Standard

Be the first to review this product
SKU
PH322513
ATG9A MS Standard C13 and N15-labeled recombinant protein (NP_076990)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349636 Rabbit Polyclonal Anti-ATG9A Antibody
100 ul
$205.00
LY411357 Transient overexpression lysate of ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "ATG9A or NM_024085"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222513
Predicted MW 94.3 kDa
Protein Sequence
Protein Sequence
>RC222513 representing NM_024085
Red=Cloning site Green=Tags(s)

MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFTCMLIGEIFEL
MQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQVCSARIQENGSLITILVIAG
VFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDIYH
RILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRL
ELAQRLSNRILWIGIANFLLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHEL
QSRLNRGYKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV
CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLIL
IFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTELSLMHF
AITNPGWQPPRESTAFLGFLKEQVQRDGAAASLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSC
RGPPLPRDLQGSRHRAEVASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLVLSE
YASTEMSLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPG
APETTALHGGFQRRYGGITDPGTVPRVPSHFSRLPLGGWAEDGQSASRHPEPVPEEGSEDELPPQVHKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076990
RefSeq Size 3816
RefSeq ORF 2517
Synonyms APG9L1; mATG9; MGD3208
Locus ID 79065
UniProt ID Q7Z3C6
Cytogenetics 2q35
Summary Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. Cycles between a juxta-nuclear trans-Golgi network compartment and late endosomes. Nutrient starvation induces accumulation on autophagosomes. Starvation-dependent trafficking requires ULK1, ATG13 and SUPT20H.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ATG9A" proteins (7)
SKU Description Size Price
LC411357 Lyophilized ATG9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421380 Lyophilized ATG9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425839 Lyophilized ATG9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411357 Transient overexpression lysate of ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY421380 Transient overexpression lysate of ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY425839 Transient overexpression lysate of ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP322513 Recombinant protein of human ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

SLC33A1/AT-1 protein regulates the induction of autophagy downstream of IRE1/XBP1 pathway
Pehar, Jonas, Hare et al
J. Biol. Chem. (2012) 287 (35), 29921-30 DOI: 10.1074/jbc.M112.363911
Cited by 5
AI Summary: OriGene’s human AT-1 (NM_004733) cDNA (catalog #SC117182) was used in this study to investigate the role of SLC33A1/AT-1 in autophagy regulation downstream of the IRE1/XBP1 pathway.
Snippet: Plasmid Constructs. Human AT-1 (NM_004733) cDNA was obtained from OriGene (SC117182) and cloned into pcDNA3.1AMyc/His (Invitrogen) and pcDNA3.1V5/His/ TOPO (Invitrogen) (14). The cDNA of human Atg9A (NM_024085
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products