ATG9A (NM_024085) Human Recombinant Protein

SKU
TP322513
Recombinant protein of human ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222513 representing NM_024085
Red=Cloning site Green=Tags(s)

MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFTCMLIGEIFEL
MQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQVCSARIQENGSLITILVIAG
VFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDIYH
RILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRL
ELAQRLSNRILWIGIANFLLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHEL
QSRLNRGYKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV
CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLIL
IFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTELSLMHF
AITNPGWQPPRESTAFLGFLKEQVQRDGAAASLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSC
RGPPLPRDLQGSRHRAEVASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLVLSE
YASTEMSLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPG
APETTALHGGFQRRYGGITDPGTVPRVPSHFSRLPLGGWAEDGQSASRHPEPVPEEGSEDELPPQVHKV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 94.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076990
Locus ID 79065
UniProt ID Q7Z3C6
Cytogenetics 2q35
RefSeq Size 3816
RefSeq ORF 2517
Synonyms APG9L1; mATG9; MGD3208
Summary Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. Cycles between a juxta-nuclear trans-Golgi network compartment and late endosomes. Nutrient starvation induces accumulation on autophagosomes. Starvation-dependent trafficking requires ULK1, ATG13 and SUPT20H.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ATG9A (NM_024085) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH322513 ATG9A MS Standard C13 and N15-labeled recombinant protein (NP_076990) 10 ug
$3,255.00
LC411357 ATG9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421380 ATG9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425839 ATG9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411357 Transient overexpression lysate of ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 2 100 ug
$665.00
LY421380 Transient overexpression lysate of ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 1 100 ug
$665.00
LY425839 Transient overexpression lysate of ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 1 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.