OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

plasticity related gene 3 (PLPPR1) (NM_207299) Human Mass Spec Standard

Be the first to review this product
SKU
PH322205
LPPR1 MS Standard C13 and N15-labeled recombinant protein (NP_997182)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404081 Transient overexpression lysate of lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "plasticity related gene 3 or NM_207299"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222205
Predicted MW 35.8 kDa
Protein Sequence
Protein Sequence
>RC222205 protein sequence
Red=Cloning site Green=Tags(s)

MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITP
LVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDI
FVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALY
ATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK
GTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997182
RefSeq Size 2461
RefSeq ORF 975
Synonyms LPPR1; PRG-3
Locus ID 54886
UniProt ID Q8TBJ4
Cytogenetics 9q31.1
Summary This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. provided by RefSeq, Jul 2008
Protein Families Phosphatase, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "plasticity related gene 3" proteins (5)
SKU Description Size Price
LC404081 Lyophilized LPPR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413579 Lyophilized LPPR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404081 Transient overexpression lysate of lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY413579 Transient overexpression lysate of lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP322205 Recombinant protein of human plasticity related gene 3 (PRG-3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products