plasticity related gene 3 (PLPPR1) (NM_207299) Human Tagged ORF Clone

SKU
RC222205
LPPR1 (Myc-DDK-tagged)-Human lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol plasticity related gene 3
Synonyms LPPR1; PRG-3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222205 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTAGGAAACAACACTCAACGAAGTTATTCCATCATCCCGTGTTTTATATTTGTTGAGCTTGTCA
TCATGGCTGGGACAGTGCTGCTTGCCTACTACTTCGAATGCACTGACACTTTTCAGGTGCATATCCAAGG
ATTCTTCTGTCAGGACGGAGACTTAATGAAGCCTTACCCAGGGACAGAGGAAGAAAGCTTCATCACCCCT
CTGGTGCTCTATTGTGTGCTGGCTGCCACCCCAACTGCTATTATTTTTATTGGTGAGATATCCATGTATT
TCATAAAATCAACAAGAGAATCCCTGATTGCTCAGGAGAAAACAATTCTGACCGGAGAATGCTGTTACCT
GAACCCCTTACTTCGAAGGATCATAAGATTCACAGGGGTGTTTGCATTTGGACTTTTTGCTACTGACATT
TTTGTAAACGCCGGACAAGTGGTCACTGGGCACTTAACGCCATACTTCCTGACTGTGTGCAAGCCAAACT
ACACCAGTGCAGACTGCCAAGCGCACCACCAGTTTATAAACAATGGGAACATTTGTACTGGGGACCTGGA
AGTGATAGAAAAGGCTCGGAGATCCTTTCCCTCCAAACACGCTGCTCTGAGCATTTACTCCGCCTTATAT
GCCACGATGTATATTACAAGCACAATCAAGACGAAGAGCAGTCGACTGGCCAAGCCGGTGCTGTGCCTCG
GAACTCTCTGCACAGCCTTCCTGACAGGCCTCAACCGGGTCTCTGAGTATCGGAACCACTGCTCGGACGT
GATTGCTGGTTTCATCCTGGGCACTGCAGTGGCCCTGTTTCTGGGAATGTGTGTGGTTCATAACTTTAAA
GGAACGCAAGGATCTCCTTCCAAACCCAAGCCTGAGGATCCCCGTGGAGTACCCCTAATGGCTTTCCCAA
GGATAGAAAGCCCTCTGGAAACCTTAAGTGCACAGAATCACTCTGCGTCCATGACCGAAGTTACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222205 protein sequence
Red=Cloning site Green=Tags(s)

MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITP
LVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDI
FVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALY
ATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK
GTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_207299
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_207299.2
RefSeq Size 2461 bp
RefSeq ORF 978 bp
Locus ID 54886
UniProt ID Q8TBJ4
Cytogenetics 9q31.1
Protein Families Phosphatase, Transmembrane
MW 35.8 kDa
Summary This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:plasticity related gene 3 (PLPPR1) (NM_207299) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222205L3 Lenti ORF clone of Human lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC222205L4 Lenti ORF clone of Human lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG222205 LPPR1 (tGFP-tagged) - Human lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1 10 ug
$500.00
SC128050 LPPR1 (untagged)-ORIGENE UNIQUE VARIANT 1 of Human lipid phosphate phosphatase-related protein type 1 (LPPR1) 10 ug
$300.00
SC310534 LPPR1 (untagged)-Human lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.