plasticity related gene 3 (PLPPR1) (NM_207299) Human Recombinant Protein

SKU
TP322205
Recombinant protein of human plasticity related gene 3 (PRG-3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222205 protein sequence
Red=Cloning site Green=Tags(s)

MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITP
LVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDI
FVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALY
ATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK
GTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_997182
Locus ID 54886
UniProt ID Q8TBJ4
Cytogenetics 9q31.1
RefSeq Size 2461
RefSeq ORF 975
Synonyms LPPR1; PRG-3
Summary This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]
Protein Families Phosphatase, Transmembrane
Write Your Own Review
You're reviewing:plasticity related gene 3 (PLPPR1) (NM_207299) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH322205 LPPR1 MS Standard C13 and N15-labeled recombinant protein (NP_997182) 10 ug
$3,255.00
LC404081 LPPR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413579 LPPR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404081 Transient overexpression lysate of lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1 100 ug
$436.00
LY413579 Transient overexpression lysate of lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.