OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERGIC3 (NM_198398) Human Mass Spec Standard

Be the first to review this product
SKU
PH322204
ERGIC3 MS Standard C13 and N15-labeled recombinant protein (NP_938408)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365816 ERGIC3 rabbit polyclonal antibody
100 ul
$310.00
LY402478 Transient overexpression lysate of ERGIC and golgi 3 (ERGIC3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "ERGIC3 or NM_198398"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222204
Predicted MW 43.6 kDa
Protein Sequence
Protein Sequence
>RC222204 representing NM_198398
Red=Cloning site Green=Tags(s)

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKI
NIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPD
RCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKV
AGNFHFAPGKSFQQSHVHVHAVEIHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMM
FQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFL
TGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_938408
RefSeq Size 1383
RefSeq ORF 1164
Synonyms C2orf47; C20orf47; CGI-54; dJ477O4.2; Erv46; NY-BR-84; PRO0989; SDBCAG84
Locus ID 51614
UniProt ID Q9Y282
Cytogenetics 20q11.22
Summary Possible role in transport between endoplasmic reticulum and Golgi.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ERGIC3" proteins (7)
SKU Description Size Price
PH304084 ERGIC3 MS Standard C13 and N15-labeled recombinant protein (NP_057050) 10 ug
$3,360.00
LC402478 Lyophilized ERGIC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405049 Lyophilized ERGIC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402478 Transient overexpression lysate of ERGIC and golgi 3 (ERGIC3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY405049 Transient overexpression lysate of ERGIC and golgi 3 (ERGIC3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304084 Recombinant protein of human ERGIC and golgi 3 (ERGIC3), transcript variant 2, 20 µg 20 ug
$867.00
TP322204 Recombinant protein of human ERGIC and golgi 3 (ERGIC3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products