OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD36 (NM_001001548) Human Mass Spec Standard

Be the first to review this product
SKU
PH321976
CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001001548)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500921 Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4) 100 ul
$447.00
LY424373 Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "CD36 or NM_001001548"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221976
Predicted MW 53.1 kDa
Protein Sequence
Protein Sequence
>RC221976 protein sequence
Red=Cloning site Green=Tags(s)

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV
QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL
AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG
VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE
SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS
PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001001548
RefSeq Size 4727
RefSeq ORF 1416
Synonyms BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3
Locus ID 948
UniProt ID P16671
Cytogenetics 7q21.11
Summary The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Feb 2014
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway, ECM-receptor interaction, Hematopoietic cell lineage, PPAR signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD36" proteins (14)
SKU Description Size Price
PH303254 CD36 MS Standard C13 and N15-labeled recombinant protein (NP_000063) 10 ug
$3,360.00
PH325799 CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120915) 10 ug
$3,360.00
PH325800 CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120916) 10 ug
$3,360.00
LC400018 Lyophilized CD36 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424372 Lyophilized CD36 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424373 Lyophilized CD36 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400018 Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY424372 Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY424373 Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP303254 Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3, 20 µg 20 ug
$867.00
TP321976 Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1, 20 µg 20 ug
$867.00
TP325799 Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 4, 20 µg 20 ug
$867.00
TP325800 Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 5, 20 µg 20 ug
$867.00
TP710013 Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36),full length,with C-terminal polyhistidine tag, expressed in sf9 cell 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products