CD36 (NM_000072) Human Mass Spec Standard

SKU
PH303254
CD36 MS Standard C13 and N15-labeled recombinant protein (NP_000063)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203254]
Predicted MW 53.1 kDa
Protein Sequence
Protein Sequence
>RC203254 protein sequence
Red=Cloning site Green=Tags(s)

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV
QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL
AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG
VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE
SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS
PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000063
RefSeq Size 2108
RefSeq ORF 1416
Synonyms BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3
Locus ID 948
UniProt ID P16671
Cytogenetics 7q21.11
Summary The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway, ECM-receptor interaction, Hematopoietic cell lineage, PPAR signaling pathway
Write Your Own Review
You're reviewing:CD36 (NM_000072) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321976 CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001001548) 10 ug
$3,255.00
PH325799 CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120915) 10 ug
$3,255.00
PH325800 CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120916) 10 ug
$3,255.00
LC400018 CD36 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424372 CD36 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424373 CD36 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400018 Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3 100 ug
$436.00
LY424372 Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 2 100 ug
$665.00
LY424373 Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 100 ug
$665.00
TP303254 Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3, 20 µg 20 ug
$867.00
TP321976 Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1, 20 µg 20 ug
$867.00
TP325799 Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 4, 20 µg 20 ug
$867.00
TP325800 Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 5, 20 µg 20 ug
$867.00
TP710013 Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36),full length,with C-terminal polyhistidine tag, expressed in sf9 cell 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.