OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD36 (NM_001001548) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC221976
CD36 (Myc-DDK-tagged)-Human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA500921 Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CD36 or NM_001001548"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD36
Synonyms BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221976 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGTGACCGGAACTGTGGGCTCATCGCTGGGGCTGTCATTGGTGCTGTCCTGGCTGTGTTTGGAG
GTATTCTAATGCCAGTTGGAGACCTGCTTATCCAGAAGACAATTAAAAAGCAAGTTGTCCTCGAAGAAGG
TACAATTGCTTTTAAAAATTGGGTTAAAACAGGCACAGAAGTTTACAGACAGTTTTGGATCTTTGATGTG
CAAAATCCACAGGAAGTGATGATGAACAGCAGCAACATTCAAGTTAAGCAAAGAGGTCCTTATACGTACA
GAGTTCGTTTTCTAGCCAAGGAAAATGTAACCCAGGACGCTGAGGACAACACAGTCTCTTTCCTGCAGCC
CAATGGTGCCATCTTCGAACCTTCACTATCAGTTGGAACAGAGGCTGACAACTTCACAGTTCTCAATCTG
GCTGTGGCAGCTGCATCCCATATCTATCAAAATCAATTTGTTCAAATGATCCTCAATTCACTTATTAACA
AGTCAAAATCTTCTATGTTCCAAGTCAGAACTTTGAGAGAACTGTTATGGGGCTATAGGGATCCATTTTT
GAGTTTGGTTCCATACCCTGTTACTACCACAGTTGGTCTGTTTTATCCTTACAACAATACTGCAGATGGA
GTTTATAAAGTTTTCAATGGAAAAGATAACATAAGTAAAGTTGCCATAATCGACACATATAAAGGTAAAA
GGAATCTGTCCTATTGGGAAAGTCACTGCGACATGATTAATGGTACAGATGCAGCCTCATTTCCACCTTT
TGTTGAGAAAAGCCAGGTATTGCAGTTCTTTTCTTCTGATATTTGCAGGTCAATCTATGCTGTATTTGAA
TCCGACGTTAATCTGAAAGGAATCCCTGTGTATAGATTTGTTCTTCCATCCAAGGCCTTTGCCTCTCCAG
TTGAAAACCCAGACAACTATTGTTTCTGCACAGAAAAAATTATCTCAAAAAATTGTACATCATATGGTGT
GCTAGACATCAGCAAATGCAAAGAAGGGAGACCTGTGTACATTTCACTTCCTCATTTTCTGTATGCAAGT
CCTGATGTTTCAGAACCTATTGATGGATTAAACCCAAATGAAGAAGAACATAGGACATACTTGGATATTG
AACCTATAACTGGATTCACTTTACAATTTGCAAAACGGCTGCAGGTCAACCTATTGGTCAAGCCATCAGA
AAAAATTCAAGTATTAAAGAATCTGAAGAGGAACTATATTGTGCCTATTCTTTGGCTTAATGAGACTGGG
ACCATTGGTGATGAGAAGGCAAACATGTTCAGAAGTCAAGTAACTGGAAAAATAAACCTCCTTGGCCTGA
TAGAAATGATCTTACTCAGTGTTGGTGTGGTGATGTTTGTTGCTTTTATGATTTCATATTGTGCATGCAG
ATCGAAAACAATAAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC221976 protein sequence
Red=Cloning site Green=Tags(s)

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV
QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL
AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG
VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE
SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS
PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001001548
ORF Size 1416 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001001548.2
RefSeq Size 4727 bp
RefSeq ORF 1419 bp
Locus ID 948
UniProt ID P16671
Cytogenetics 7q21.11
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway, ECM-receptor interaction, Hematopoietic cell lineage, PPAR signaling pathway
MW 53.1 kDa
Summary The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Feb 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001001548" in other vectors (6)
SKU Description Size Price
RC221976L1 Lenti ORF clone of Human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC221976L2 Lenti ORF clone of Human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1, mGFP tagged 10 ug
$757.00
RC221976L3 Lenti ORF clone of Human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC221976L4 Lenti ORF clone of Human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1, mGFP tagged 10 ug
$757.00
RG221976 CD36 (tGFP-tagged) - Human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 10 ug
$489.00 $657.00
SC300210 CD36 (untagged)-Human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 10 ug
$457.00

Plasmid Map for RC221976

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC221976
Circular map for RC221976

file-alt Citations

Lipoprotein (a) Triggers CD36-Dependent IL-6/RhoA-GTP Axis Activation and Epigenetic Regulation of miRNA Expression in Coronary Artery Spasm
Lin, Hsieh, Yeh et al
Preprints (2025)
AI Summary: OriGene products, specifically the CD36-targeting short hairpin RNA (Cat # TL314090) and CD36 overexpression vector (Cat # RC221976), were used to manipulate CD36 expression in human coronary artery smooth muscle cells, enabling the study of CD36’s role in Lp(a)-induced signaling pathways in coronary artery spasm.
Snippet: available short hairpin RNA targeting CD36 (Origene, Cat # TL314090). For and its corresponding empty vector were obtained from Origene (Cat #RC221976). HCASMCs
Pathogenic effects of Desulfovibrio in the gut on fatty liver in diet-induced obese mice and children with obesity
Lin, Lin, Wu et al
J Gastroenterol (2022)
Cited by 86
AI Summary: OriGene products, specifically the plasmid-pCD36 (RC221976) and the control vector pCMV6-entry (PS100001), were used in this study to manipulate CD36 expression in HepG2 cells, enabling investigation of CD36’s role in lipid accumulation related to fatty liver disease.
Snippet: For CD36 overexpression experiment, plasmid-pCD36 (RC221976) and the control vector pCMV6-entry (PS100001) were purchased from OriGene Technologies
Upregulation of CD36, a Fatty Acid Translocase, Promotes Colorectal Cancer Metastasis by Increasing MMP28 and Decreasing E-Cadherin Expression
Drury, Rychahou, Kelson et al
Cancers (Basel) (2022) 14 (1) DOI: 10.3390/cancers14010252
Cited by 64
AI Summary: OriGene products pLenti-C-Myc-DDK-P2A-Puro-CD36 overexpression (RC221976L1V) and pLenti-C-Myc-DDK-P2A-Puro-Empty-Vector (PS1000064) were used to generate colorectal cancer cell lines with altered CD36 expression, enabling the study of CD36's role in cancer metastasis in this paper.
Snippet: prior to performing in vitro and in vivo experiments. Overexpression cell lines were established by transfecting HCT116 and HT29 LuM0 cells with either pLenti-C-Myc-DDK-P2A-Puro-CD36 overexpression (OriGene #RC221976L1V) or pLenti-C-Myc-DDK-P2A-Puro-Empty-Vector (OriGene #PS1000064) lentiviral transduction particles. MMP28 knockdown cell lines were generated by transfecting CRC cells with scrambl
FigureFigureFigure
Fluorescent labelling of membrane fatty acid transporter CD36 (SR-B2) in the extracellular loop
Liu, Rodriguez-Calvo, Wang et al
PLoS ONE (2019) 14 (1), e0210704 DOI: 10.1371/journal.pone.0210704
AI Summary: OriGene’s pCMV6 construct was used as the source for the three mutant CD36 sequences, which were excised and subcloned for lentiviral transduction in the study.
Snippet: The three mutant sequences of CD36 were cut from pCMV6 construct (Origene, Rockville, United States) using the restriction enzymes, BglII/SmaI, and subcloned to the lentiviral vector pLVX by ligation to the same restriction sites Cached
Ligand-induced growth and compaction of CD36 nanoclusters enriched in Fyn induces Fyn signaling
Githaka, Vega, Baird et al
J. Cell. Sci. (2016) 129 (22), 4175-4189 DOI: 10.1242/jcs.188946
Cited by 41
AI Summary: OriGene contributed to this study by providing the human CD36 cDNA (OriGene Technologies), which was used to express CD36 and investigate its nanoclustering and role in Fyn signaling.
Snippet: ...Human CD36 cDNA was obtained from Origene (OriGene Technologies). The coding sequence...Cell Signaling;1:1000) antibodies, respectively. Anti-Fyn...Sigma-Aldrich;1:10,000) antibodies were used to probe for total...
Selenoprotein K is required for palmitoylation of CD36 in macrophages: implications in foam cell formation and atherogenesis
Meiler, Baumer, Huang et al
J. Leukoc. Biol. (2013) 93 (5), 771-80 DOI: 10.1189/jlb.1212647
Cited by 75
AI Summary: In this study, anti-FLAG-coated magnetic beads from OriGene were used to immunoprecipitate FLAG-tagged CD36 protein, enabling the analysis of its palmitoylation status in macrophages.
Snippet: The precleared lysates were then incubated with anti-FLAG-coated magnetic beads (OriGene) overnight, followed by Click-iT conjugation of ... Note that bands below the 75-kD marker band correspond to the palmitoylated FLAG-CD36 protein, whereas the bands above the 75-kD
IP
Showing 1-6 of 6 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products