OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LUC7L (NM_201412) Human Mass Spec Standard

Be the first to review this product
SKU
PH321529
LUC7L MS Standard C13 and N15-labeled recombinant protein (NP_958815)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344587 Rabbit Polyclonal Anti-LUC7L Antibody - middle region
100 ul
$585.00
LY403707 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "LUC7L or NM_201412"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221529
Predicted MW 43.5 kDa
Protein Sequence
Protein Sequence
>RC221529 protein sequence
Red=Cloning site Green=Tags(s)

MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD
YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA
EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF
GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS
RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958815
RefSeq Size 1452
RefSeq ORF 1113
Synonyms hLuc7B1; Luc7; LUC7B1; SR+89
Locus ID 55692
UniProt ID Q9NQ29
Cytogenetics 16p13.3
Summary The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 PubMed 11170747).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LUC7L" proteins (7)
SKU Description Size Price
LC403707 Lyophilized LUC7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413372 Lyophilized LUC7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429566 Lyophilized LUC7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403707 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY413372 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY429566 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP321529 Recombinant protein of human LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products