LUC7L (NM_201412) Human Recombinant Protein

SKU
TP321529
Recombinant protein of human LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221529 representing NM_201412
Red=Cloning site Green=Tags(s)

MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD
YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA
EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF
GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS
RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWR
LESSNGKMASRRSEEKEAGEI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 43.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_958815
Locus ID 55692
UniProt ID Q9NQ29
Cytogenetics 16p13.3
RefSeq Size 1452
RefSeq ORF 1113
Synonyms hLuc7B1; Luc7; LUC7B1; SR+89
Summary The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:LUC7L (NM_201412) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321529 LUC7L MS Standard C13 and N15-labeled recombinant protein (NP_958815) 10 ug
$3,255.00
LC403707 LUC7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413372 LUC7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429566 LUC7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403707 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2 100 ug
$436.00
LY413372 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 100 ug
$436.00
LY429566 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.