LUC7L (NM_201412) Human Mass Spec Standard

SKU
PH321529
LUC7L MS Standard C13 and N15-labeled recombinant protein (NP_958815)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221529]
Predicted MW 43.5 kDa
Protein Sequence
Protein Sequence
>RC221529 representing NM_201412
Red=Cloning site Green=Tags(s)

MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD
YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA
EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF
GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS
RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWR
LESSNGKMASRRSEEKEAGEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958815
RefSeq Size 1452
RefSeq ORF 1113
Synonyms hLuc7B1; Luc7; LUC7B1; SR+89
Locus ID 55692
UniProt ID Q9NQ29
Cytogenetics 16p13.3
Summary The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:LUC7L (NM_201412) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403707 LUC7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413372 LUC7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429566 LUC7L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403707 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2 100 ug
$436.00
LY413372 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 100 ug
$436.00
LY429566 Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 100 ug
$436.00
TP321529 Recombinant protein of human LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.