OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NOVA1 (NM_006489) Human Mass Spec Standard

Be the first to review this product
SKU
PH321328
NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006480)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308650 Rabbit polyclonal antibody to NOVA1 (neuro-oncological ventral antigen 1)
100 ul
$665.00
LY400898 Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NOVA1 or NM_006489"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221328
Predicted MW 49.1 kDa
Protein Sequence
Protein Sequence
>RC221328 representing NM_006489
Red=Cloning site Green=Tags(s)

MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ
TIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQT
TVNPDRIKQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAV
ELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAFPAVL
SGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATYASEASASGS
TAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTL
VEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006480
RefSeq Size 3846
RefSeq ORF 1449
Synonyms Nova-1
Locus ID 4857
UniProt ID P51513
Cytogenetics 14q12
Summary This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NOVA1" proteins (7)
SKU Description Size Price
PH310407 NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_002506) 10 ug
$3,360.00
LC400898 Lyophilized NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416609 Lyophilized NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400898 Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY416609 Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP310407 Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1, 20 µg 20 ug
$737.00
TP321328 Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products