NOVA1 (NM_002515) Human Mass Spec Standard

SKU
PH310407
NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_002506)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210407]
Predicted MW 51.7 kDa
Protein Sequence
Protein Sequence
>RC210407 protein sequence
Red=Cloning site Green=Tags(s)

MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ
TIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQT
TVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQK
PDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLP
TAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAA
SANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGS
KDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQ
RITYEQGVRAANPQKVG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002506
RefSeq Size 3918
RefSeq ORF 1521
Synonyms Nova-1
Locus ID 4857
UniProt ID P51513
Cytogenetics 14q12
Summary This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NOVA1 (NM_002515) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321328 NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006480) 10 ug
$3,255.00
LC400898 NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416609 NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400898 Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1 100 ug
$436.00
LY416609 Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2 100 ug
$665.00
TP310407 Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1, 20 µg 20 ug
$737.00
TP321328 Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.