OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RIOK1 (NM_031480) Human Mass Spec Standard

Be the first to review this product
SKU
PH320667
RIOK1 MS Standard C13 and N15-labeled recombinant protein (NP_113668)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410475 Transient overexpression lysate of RIO kinase 1 (yeast) (RIOK1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RIOK1 or NM_031480"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220667
Predicted MW 65.4 kDa
Protein Sequence
Protein Sequence
>RC220667 representing NM_031480
Red=Cloning site Green=Tags(s)

MDYRRLLMSRVVPGQFDDADSSDSENRDLKTVKEKDDILFEDLQDNVNENGEGEIEDEEEEGYDDDDDDW
DWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKINLDKLNVTDSVINKVTEKSR
QKEADMYRIKDKADRATVEQVLDPRTRMILFKMLTRGIITEINGCISTGKEANVYHASTANGESRAIKIY
KTSILVFKDRDKYVSGEFRFRHGYCKGNPRKMVKTWAEKEMRNLIRLNTAEIPCPEPIMLRSHVLVMSFI
GKDDMPAPLLKNVQLSESKARELYLQVIQYMRRMYQDARLVHADLSEFNMLYHGGGVYIIDVSQSVEHDH
PHALEFLRKDCANVNDFFMRHSVAVMTVRELFEFVTDPSITHENMDAYLSKAMEIASQRTKEERSSQDHV
DEEVFKRAYIPRTLNEVKNYERDMDIIMKLKEEDMAMNAQQDNILYQTVTGLKKDLSGVQKVPALLENQV
EERTCSDSEDIGSSECSDTDSEEQGDHARPKKHTTDPDIDKKERKKMVKEAQREKRKNKIPKHVKKRKEK
TAKTKKGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_113668
RefSeq Size 2495
RefSeq ORF 1704
Synonyms AD034; bA288G3.1; RIO1; RRP10
Locus ID 83732
UniProt ID Q9BRS2
Cytogenetics 6p24.3
Summary The protein encoded by this gene competes with pICln for inclusion in the protein arginine methyltransferase 5 complex. This complex targets substrates for dimethylation. The encoded protein is essential for the last steps in the maturation of 40S subunits. provided by RefSeq, Jan 2017
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RIOK1" proteins (5)
SKU Description Size Price
PH302947 RIOK1 MS Standard C13 and N15-labeled recombinant protein (NP_694550) 10 ug
$3,360.00
LC410475 Lyophilized RIOK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410475 Transient overexpression lysate of RIO kinase 1 (yeast) (RIOK1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302947 Recombinant protein of human RIO kinase 1 (yeast) (RIOK1), transcript variant 2, 20 µg 20 ug
$867.00
TP320667 Recombinant protein of human RIO kinase 1 (yeast) (RIOK1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products