RIOK1 (NM_153005) Human Mass Spec Standard

SKU
PH302947
RIOK1 MS Standard C13 and N15-labeled recombinant protein (NP_694550)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202947]
Predicted MW 65.6 kDa
Protein Sequence
Protein Sequence
>RC202947 representing NM_153005
Red=Cloning site Green=Tags(s)

MDYRRLLMSRVVPGQFDDADSSDSENRDLKTVKEKDDILFEDLQDNVNENGEGEIEDEEEEGYDDDDDDW
DWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKINLDKLNVTDSVINKVTEKSR
QKEADMYRIKDKADRATVEQVLDPRTRMILFKMLTRGIITEINGCISTGKEANVYHASTANGESRAIKIY
KTSILVFKDRDKYVSGEFRFRHGYCKGNPRKMVKTWAEKEMRNLIRLNTAEIPCPEPIMLRSHVLVMSFI
GKDDMPAPLLKNVQLSESKARELYLQVIQYMRRMYQDARLVHADLSEFNMLYHGGGVYIIDVSQSVEHDH
PHALEFLRKDCANVNDFFMRHSVAVMTVRELFEFVTDPSITHENMDAYLSKAMEIASQRTKEERSSQDHV
DEEVFKRAYIPRTLNEVKNYERDMDIIMKLKEEDMAMNAQQDNILYQTVTGLKKDLSGVQKVPALLENQV
EERTCSDSEDIGSSECSDTDSEEQGDHARPKKHTTDPDIDKKERKKMVKEAQREKRKNKIPKHVKKRKEK
TAKTKKGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_694550
RefSeq Size 1796
RefSeq ORF 1704
Synonyms AD034; bA288G3.1; RRP10
Locus ID 83732
UniProt ID Q9BRS2
Cytogenetics 6p24.3
Summary The protein encoded by this gene competes with pICln for inclusion in the protein arginine methyltransferase 5 complex. This complex targets substrates for dimethylation. The encoded protein is essential for the last steps in the maturation of 40S subunits. [provided by RefSeq, Jan 2017]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:RIOK1 (NM_153005) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320667 RIOK1 MS Standard C13 and N15-labeled recombinant protein (NP_113668) 10 ug
$3,255.00
LC410475 RIOK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410475 Transient overexpression lysate of RIO kinase 1 (yeast) (RIOK1), transcript variant 1 100 ug
$436.00
TP302947 Recombinant protein of human RIO kinase 1 (yeast) (RIOK1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320667 Recombinant protein of human RIO kinase 1 (yeast) (RIOK1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.