OriGene Logo

RIOK1 (NM_031480) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP320667
Recombinant protein of human RIO kinase 1 (yeast) (RIOK1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
In Control Promo
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RIOK1 or NM_031480"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220667 representing NM_031480
Red=Cloning site Green=Tags(s)

MDYRRLLMSRVVPGQFDDADSSDSENRDLKTVKEKDDILFEDLQDNVNENGEGEIEDEEEEGYDDDDDDW
DWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKINLDKLNVTDSVINKVTEKSR
QKEADMYRIKDKADRATVEQVLDPRTRMILFKMLTRGIITEINGCISTGKEANVYHASTANGESRAIKIY
KTSILVFKDRDKYVSGEFRFRHGYCKGNPRKMVKTWAEKEMRNLIRLNTAEIPCPEPIMLRSHVLVMSFI
GKDDMPAPLLKNVQLSESKARELYLQVIQYMRRMYQDARLVHADLSEFNMLYHGGGVYIIDVSQSVEHDH
PHALEFLRKDCANVNDFFMRHSVAVMTVRELFEFVTDPSITHENMDAYLSKAMEIASQRTKEERSSQDHV
DEEVFKRAYIPRTLNEVKNYERDMDIIMKLKEEDMAMNAQQDNILYQTVTGLKKDLSGVQKVPALLENQV
EERTCSDSEDIGSSECSDTDSEEQGDHARPKKHTTDPDIDKKERKKMVKEAQREKRKNKIPKHVKKRKEK
TAKTKKGK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 65.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_113668
Locus ID 83732
UniProt ID Q9BRS2
Cytogenetics 6p24.3
RefSeq Size 2495
RefSeq ORF 1704
Synonyms AD034; bA288G3.1; RIO1; RRP10
Summary The protein encoded by this gene competes with pICln for inclusion in the protein arginine methyltransferase 5 complex. This complex targets substrates for dimethylation. The encoded protein is essential for the last steps in the maturation of 40S subunits. provided by RefSeq, Jan 2017
Protein Categories Enzyme: Kinases, Intracellular Proteins
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "RIOK1" proteins (5)
SKU Description Size Price
PH302947 RIOK1 MS Standard C13 and N15-labeled recombinant protein (NP_694550) 10 ug
$3,360.00
PH320667 RIOK1 MS Standard C13 and N15-labeled recombinant protein (NP_113668) 10 ug
$3,360.00
LC410475 RIOK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410475 Transient overexpression lysate of RIO kinase 1 (yeast) (RIOK1), transcript variant 1 100 ug
$436.00
TP302947 Recombinant protein of human RIO kinase 1 (yeast) (RIOK1), transcript variant 2, 20 µg 20 ug
$867.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.