OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MEF2C (NM_002397) Human Mass Spec Standard

Be the first to review this product
SKU
PH320584
MEF2C MS Standard C13 and N15-labeled recombinant protein (NP_002388)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502565 MEF2C mouse monoclonal antibody, clone OTI1H5 (formerly 1H5) 100 ul
$447.00
LY419349 Transient overexpression lysate of myocyte enhancer factor 2C (MEF2C), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MEF2C or NM_002397"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220584
Predicted MW 51 kDa
Protein Sequence
Protein Sequence
>RC220584 representing NM_002397
Red=Cloning site Green=Tags(s)

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYT
EYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPN
FEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGT
SAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQ
RINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW
QQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002388
RefSeq Size 4077
RefSeq ORF 1419
Synonyms C5DELq14.3; DEL5q14.3
Locus ID 4208
UniProt ID Q06413
Cytogenetics 5q14.3
Summary This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe cognitive disability, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described. provided by RefSeq, Jul 2010
Protein Families Transcription Factors
Protein Pathways MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MEF2C" proteins (5)
SKU Description Size Price
LC419349 Lyophilized MEF2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434220 Lyophilized MEF2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419349 Transient overexpression lysate of myocyte enhancer factor 2C (MEF2C), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY434220 Transient overexpression lysate of myocyte enhancer factor 2C (MEF2C), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP320584 Recombinant protein of human myocyte enhancer factor 2C (MEF2C), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products