OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MEF2C (NM_002397) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP320584
Recombinant protein of human myocyte enhancer factor 2C (MEF2C), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA502565 MEF2C mouse monoclonal antibody, clone OTI1H5 (formerly 1H5) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MEF2C or NM_002397"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220584 representing NM_002397
Red=Cloning site Green=Tags(s)

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYT
EYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPN
FEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGT
SAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQ
RINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW
QQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002388
Locus ID 4208
UniProt ID Q06413
Cytogenetics 5q14.3
RefSeq Size 4077
RefSeq ORF 1419
Synonyms C5DELq14.3; DEL5q14.3
Summary This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe cognitive disability, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described. provided by RefSeq, Jul 2010
Protein Categories Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Protein Pathways MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MEF2C" proteins (5)
SKU Description Size Price
PH320584 MEF2C MS Standard C13 and N15-labeled recombinant protein (NP_002388) 10 ug
$3,360.00
LC419349 Lyophilized MEF2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434220 Lyophilized MEF2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419349 Transient overexpression lysate of myocyte enhancer factor 2C (MEF2C), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY434220 Transient overexpression lysate of myocyte enhancer factor 2C (MEF2C), transcript variant 4 (as WB positive control) 100 ug
$436.00

file-alt Citations

Fortilin binds and stabilizes MEF2C, activates it through phosphorylation, and drives transcription of the cell structural and survival protein CTNNA3
Nakashima, Mukherjee, Pinkaew et al
Journal of Biological Chemistry (2026)
AI Summary: OriGene’s recombinant human MEF2C protein was used in binding assays to investigate and confirm the direct interaction between fortilin and MEF2C, supporting the study’s findings on fortilin-mediated stabilization and activation of MEF2C.
Snippet: ide-labeled rh-fortilin with varying concentrations of MEF2C (range: 30 pM to 250 nM;OriGene,
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products