OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Renalase (RNLS) (NM_018363) Human Mass Spec Standard

Be the first to review this product
SKU
PH320551
RNLS MS Standard C13 and N15-labeled recombinant protein (NP_060833)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351592 Rabbit Polyclonal Anti-RNLS Antibody
100 ul
$205.00
LY422160 Transient overexpression lysate of renalase, FAD-dependent amine oxidase (RNLS), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Renalase or NM_018363"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220551
Predicted MW 34.8 kDa
Protein Sequence
Protein Sequence
>RC220551 representing NM_018363
Red=Cloning site Green=Tags(s)

MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYA
KKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDD
KWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPW
AGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQP
IATKCQKWRHSQVPSAGVILGCAKSPWMMAIGFPI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060833
RefSeq Size 2107
RefSeq ORF 945
Synonyms C10orf59; RENALASE
Locus ID 55328
UniProt ID Q5VYX0
Cytogenetics 10q23.31
Summary Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 PubMed 15841207).supplied by OMIM, Mar 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Renalase" proteins (7)
SKU Description Size Price
PH302791 RNLS MS Standard C13 and N15-labeled recombinant protein (NP_001026879) 10 ug
$3,360.00
LC413115 Lyophilized RNLS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422160 Lyophilized RNLS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413115 Transient overexpression lysate of renalase, FAD-dependent amine oxidase (RNLS), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422160 Transient overexpression lysate of renalase, FAD-dependent amine oxidase (RNLS), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302791 Recombinant protein of human chromosome 10 open reading frame 59 (C10orf59), transcript variant 1, 20 µg 20 ug
$867.00
TP320551 Recombinant protein of human chromosome 10 open reading frame 59 (C10orf59), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products