Renalase (RNLS) (NM_001031709) Human Mass Spec Standard

SKU
PH302791
RNLS MS Standard C13 and N15-labeled recombinant protein (NP_001026879)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202791]
Predicted MW 37.8 kDa
Protein Sequence
Protein Sequence
>RC202791 protein sequence
Red=Cloning site Green=Tags(s)

MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYA
KKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDD
KWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPW
AGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQP
IATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001026879
RefSeq Size 2420
RefSeq ORF 1026
Synonyms C10orf59; RENALASE
Locus ID 55328
UniProt ID Q5VYX0
Cytogenetics 10q23.31
Summary Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]).[supplied by OMIM, Mar 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:Renalase (RNLS) (NM_001031709) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320551 RNLS MS Standard C13 and N15-labeled recombinant protein (NP_060833) 10 ug
$3,255.00
LC413115 RNLS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422160 RNLS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413115 Transient overexpression lysate of renalase, FAD-dependent amine oxidase (RNLS), transcript variant 2 100 ug
$436.00
LY422160 Transient overexpression lysate of renalase, FAD-dependent amine oxidase (RNLS), transcript variant 1 100 ug
$436.00
TP302791 Recombinant protein of human chromosome 10 open reading frame 59 (C10orf59), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320551 Recombinant protein of human chromosome 10 open reading frame 59 (C10orf59), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.