Renalase (RNLS) (NM_018363) Human Recombinant Protein

SKU
TP320551
Recombinant protein of human chromosome 10 open reading frame 59 (C10orf59), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220551 representing NM_018363
Red=Cloning site Green=Tags(s)

MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYA
KKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDD
KWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPW
AGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQP
IATKCQKWRHSQVPSAGVILGCAKSPWMMAIGFPI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060833
Locus ID 55328
UniProt ID Q5VYX0
Cytogenetics 10q23.31
RefSeq Size 2107
RefSeq ORF 945
Synonyms C10orf59; RENALASE
Summary Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]).[supplied by OMIM, Mar 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:Renalase (RNLS) (NM_018363) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302791 RNLS MS Standard C13 and N15-labeled recombinant protein (NP_001026879) 10 ug
$3,255.00
PH320551 RNLS MS Standard C13 and N15-labeled recombinant protein (NP_060833) 10 ug
$3,255.00
LC413115 RNLS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422160 RNLS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413115 Transient overexpression lysate of renalase, FAD-dependent amine oxidase (RNLS), transcript variant 2 100 ug
$436.00
LY422160 Transient overexpression lysate of renalase, FAD-dependent amine oxidase (RNLS), transcript variant 1 100 ug
$436.00
TP302791 Recombinant protein of human chromosome 10 open reading frame 59 (C10orf59), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.