PCSK9 (NM_174936) Human Mass Spec Standard
CAT#: PH320000
PCSK9 MS Standard C13 and N15-labeled recombinant protein (NP_777596)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220000 |
Predicted MW | 71 kDa |
Protein Sequence |
>RC220000 representing NM_174936
Red=Cloning site Green=Tags(s) MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKD PWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHV DYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPE EDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPV GPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGT LGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFS RSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLT GCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGW TLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_777596 |
RefSeq Size | 3636 |
RefSeq ORF | 2076 |
Synonyms | FH3; FHCL3; HCHOLA3; LDLCQ1; NARC-1; NARC1; PC9 |
Locus ID | 255738 |
UniProt ID | Q8NBP7 |
Cytogenetics | 1p32.3 |
Summary | This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Mutations in this gene have been associated with autosomal dominant familial hypercholesterolemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403563 | PCSK9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY403563 | Transient overexpression lysate of proprotein convertase subtilisin/kexin type 9 (PCSK9) |
USD 665.00 |
|
TP320000 | Recombinant protein of human proprotein convertase subtilisin/kexin type 9 (PCSK9), 20 µg |
USD 867.00 |
|
TP700053 | Recombinant protein of secreted form of human proprotein convertase subtilisin/kexin type 9 (PCSK9) |
USD 867.00 |
|
TP720768 | Purified recombinant protein of Human proprotein convertase subtilisin/kexin type 9 (PCSK9) |
USD 330.00 |
|
TP721051 | Purified recombinant protein of Human proprotein convertase subtilisin/kexin type 9 (PCSK9), D374Y mutant. |
USD 330.00 |
|
TP723879 | Purified recombinant protein of Human proprotein convertase subtilisin/kexin type 9 (PCSK9) |
USD 440.00 |
{0} Product Review(s)
Be the first one to submit a review