OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SMURF1 (NM_181349) Human Mass Spec Standard

Be the first to review this product
SKU
PH319536
SMURF1 MS Standard C13 and N15-labeled recombinant protein (NP_851994)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350761 Rabbit Polyclonal Anti-SMURF1 Antibody
100 ul
$205.00
LY403618 Transient overexpression lysate of SMAD specific E3 ubiquitin protein ligase 1 (SMURF1), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "SMURF1 or NM_181349"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219536
Predicted MW 83.3 kDa
Protein Sequence
Protein Sequence
>RC219536 representing NM_181349
Red=Cloning site Green=Tags(s)

MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYV
GKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTR
DRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQ
RLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELG
PLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYER
DLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVARE
WLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYK
QLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKE
YVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADS
NIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCF
NRIDIPPYESYEKLYEKLLTAVEETCGFAVE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_851994
RefSeq Size 5659
RefSeq ORF 2193
Locus ID 57154
UniProt ID Q9HCE7
Cytogenetics 7q22.1
Summary This gene encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. This protein plays a key roll in the regulation of cell motility, cell signalling, and cell polarity. Alternative splicing results in multiple transcript variants encoding different isoforms.provided by RefSeq, Dec 2010
Protein Families Druggable Genome
Protein Pathways Endocytosis, TGF-beta signaling pathway, Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SMURF1" proteins (5)
SKU Description Size Price
LC403618 Lyophilized SMURF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC412480 Lyophilized SMURF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403618 Transient overexpression lysate of SMAD specific E3 ubiquitin protein ligase 1 (SMURF1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY412480 Transient overexpression lysate of SMAD specific E3 ubiquitin protein ligase 1 (SMURF1), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP319536 Recombinant protein of human SMAD specific E3 ubiquitin protein ligase 1 (SMURF1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products