ODF3 (NM_053280) Human Mass Spec Standard

CAT#: PH319533

ODF3 MS Standard C13 and N15-labeled recombinant protein (NP_444510)

Product Images

Coomassie blue staining of purified ODF3 protein (Cat# TP319533). The protein was produced from HEK293T cells transfected with ODF3 cDNA clone (Cat# RC219533) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219533
• Predicted MW: 27.7 kDa
• Protein Sequence:
  Sequence Link

  >RC219533 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRY
  NVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPA
  AYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPG
  DKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_444510
• RefSeq Size: 1295
• RefSeq ORF: 762
• Synonyms: CT135; SHIPPO1; TISP50
• Locus ID: 113746
• UniProt ID: Q96PU9
• Cytogenetics: 11p15.5
• Summary: ODF3 is a component of sperm flagella outer dense fibers, which add stiffness, elastic recoil, and protection against shearing forces during sperm movement.[supplied by OMIM, Apr 2004]