ODF3 (NM_053280) Human Recombinant Protein

SKU
TP319533
Recombinant protein of human outer dense fiber of sperm tails 3 (ODF3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219533 protein sequence
Red=Cloning site Green=Tags(s)

MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRY
NVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPA
AYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPG
DKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_444510
Locus ID 113746
UniProt ID Q96PU9
Cytogenetics 11p15.5
RefSeq Size 1295
RefSeq ORF 762
Synonyms CT135; SHIPPO1; TISP50
Summary ODF3 is a component of sperm flagella outer dense fibers, which add stiffness, elastic recoil, and protection against shearing forces during sperm movement.[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:ODF3 (NM_053280) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319533 ODF3 MS Standard C13 and N15-labeled recombinant protein (NP_444510) 10 ug
$3,255.00
LC409298 ODF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409298 Transient overexpression lysate of outer dense fiber of sperm tails 3 (ODF3) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.