OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ODF3 (NM_053280) Human Mass Spec Standard

Be the first to review this product
SKU
PH319533
ODF3 MS Standard C13 and N15-labeled recombinant protein (NP_444510)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331342 Rabbit Polyclonal Anti-ODF3 Antibody
100 ul
$585.00
LY409298 Transient overexpression lysate of outer dense fiber of sperm tails 3 (ODF3) (as WB positive control) 100 ug
$436.00

Other products for "ODF3 or NM_053280"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219533
Predicted MW 27.7 kDa
Protein Sequence
Protein Sequence
>RC219533 protein sequence
Red=Cloning site Green=Tags(s)

MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRY
NVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPA
AYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPG
DKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_444510
RefSeq Size 1295
RefSeq ORF 762
Synonyms CT135; SHIPPO1; TISP50
Locus ID 113746
UniProt ID Q96PU9
Cytogenetics 11p15.5
Summary ODF3 is a component of sperm flagella outer dense fibers, which add stiffness, elastic recoil, and protection against shearing forces during sperm movement.supplied by OMIM, Apr 2004
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ODF3" proteins (3)
SKU Description Size Price
LC409298 Lyophilized ODF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409298 Transient overexpression lysate of outer dense fiber of sperm tails 3 (ODF3) (as WB positive control) 100 ug
$436.00
TP319533 Recombinant protein of human outer dense fiber of sperm tails 3 (ODF3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products