OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP18 (NM_152511) Human Mass Spec Standard

Be the first to review this product
SKU
PH319496
DUSP18 MS Standard C13 and N15-labeled recombinant protein (NP_689724)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY407513 Transient overexpression lysate of dual specificity phosphatase 18 (DUSP18) (as WB positive control) 100 ug
$436.00

Other products for "DUSP18 or NM_152511"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219496
Predicted MW 20.9 kDa
Protein Sequence
Protein Sequence
>RC219496 representing NM_152511
Red=Cloning site Green=Tags(s)

MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVP
VADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPI
IRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689724
RefSeq Size 2453
RefSeq ORF 564
Synonyms DSP18; DUSP20; LMWDSP20
Locus ID 150290
UniProt ID Q8NEJ0
Cytogenetics 22q12.2
Summary Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 PubMed 19228121).supplied by OMIM, Dec 2009
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUSP18" proteins (3)
SKU Description Size Price
LC407513 Lyophilized DUSP18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407513 Transient overexpression lysate of dual specificity phosphatase 18 (DUSP18) (as WB positive control) 100 ug
$436.00
TP319496 Recombinant protein of human dual specificity phosphatase 18 (DUSP18), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products