OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRPS2 (NM_001039091) Human Mass Spec Standard

Be the first to review this product
SKU
PH319227
PRPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001034180)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308129 Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
100 ul
$665.00
LY419123 Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PRPS2 or NM_001039091"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219227
Predicted MW 34.9 kDa
Protein Sequence
Protein Sequence
>RC219227 representing NM_001039091
Red=Cloning site Green=Tags(s)

MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMEL
LIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHIITMDLHASQIQGF
FDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVL
VGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQ
EDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034180
RefSeq Size 2518
RefSeq ORF 963
Synonyms PRSII
Locus ID 5634
UniProt ID P11908
Cytogenetics Xp22.2
Summary This gene encodes a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants. provided by RefSeq, Mar 2010
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pentose phosphate pathway, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRPS2" proteins (5)
SKU Description Size Price
LC419123 Lyophilized PRPS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422014 Lyophilized PRPS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419123 Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422014 Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP319227 Recombinant protein of human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products