MTUS2 (NM_015233) Human Mass Spec Standard

CAT#: PH319139

MTUS2 MS Standard C13 and N15-labeled recombinant protein (NP_056048)

Product Images

Coomassie blue staining of purified MTUS2 protein (Cat# TP319139). The protein was produced from HEK293T cells transfected with MTUS2 cDNA clone (Cat# RC219139) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219139
• Predicted MW: 40.6 kDa
• Protein Sequence:
  Sequence Link

  >RC219139 representing NM_015233
  Red=Cloning site Green=Tags(s)
  
  MGHCCCKPYNCLQCLDKTNESALVKEKELSIELANIRDEVAFHTAKCEKLQKEKEELERRFEDEVKRLGW
  QQQAELQELEERLQLQFEAEMARLQEEHGDQLLSIRCQHQEQVEDLTASHDAALLEMENNHTVAITILQD
  DHDHKVQELMSTHELEKKELEENFEKLRLSLQDQVDTLTFQSQSLRDRARRFEEALRKNTEEQLEIALAP
  YQHLEEDMKSLKQVLEMKNQQIHEQEKKILELEKLAEKNIILEEKIQVLQQQNEDLKARIDQNTVVTRQL
  SEENANLQEYVEKETQEKKRLSRTNEELLWKLQTGDPTSPIKLSPTSPVYRGSSSGPSSPARVSTTPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056048
• RefSeq Size: 1779
• RefSeq ORF: 1044
• Synonyms: CAZIP; ICIS; KIAA0774; TIP150
• Locus ID: 23281
• UniProt ID: Q5JR59, Q5JR59-3
• Cytogenetics: 13q12.3
• Summary: Binds microtubules. Together with MAPRE1 may target the microtubule depolymerase KIF2C to the plus-end of microtubules. May regulate the dynamics of microtubules at their growing distal tip.[UniProtKB/Swiss-Prot Function]