OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MTUS2 (NM_015233) Human Mass Spec Standard

Be the first to review this product
SKU
PH319139
MTUS2 MS Standard C13 and N15-labeled recombinant protein (NP_056048)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306938 Rabbit Polyclonal CAZIP Antibody
100 ug
$640.00
LY422408 Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "MTUS2 or NM_015233"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219139
Predicted MW 40.6 kDa
Protein Sequence
Protein Sequence
>RC219139 representing NM_015233
Red=Cloning site Green=Tags(s)

MGHCCCKPYNCLQCLDKTNESALVKEKELSIELANIRDEVAFHTAKCEKLQKEKEELERRFEDEVKRLGW
QQQAELQELEERLQLQFEAEMARLQEEHGDQLLSIRCQHQEQVEDLTASHDAALLEMENNHTVAITILQD
DHDHKVQELMSTHELEKKELEENFEKLRLSLQDQVDTLTFQSQSLRDRARRFEEALRKNTEEQLEIALAP
YQHLEEDMKSLKQVLEMKNQQIHEQEKKILELEKLAEKNIILEEKIQVLQQQNEDLKARIDQNTVVTRQL
SEENANLQEYVEKETQEKKRLSRTNEELLWKLQTGDPTSPIKLSPTSPVYRGSSSGPSSPARVSTTPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056048
RefSeq Size 1779
RefSeq ORF 1044
Synonyms CAZIP; ICIS; KIAA0774; TIP150
Locus ID 23281
UniProt ID Q5JR59
Cytogenetics 13q12.3
Summary Binds microtubules. Together with MAPRE1 may target the microtubule depolymerase KIF2C to the plus-end of microtubules. May regulate the dynamics of microtubules at their growing distal tip.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MTUS2" proteins (5)
SKU Description Size Price
LC414704 Lyophilized MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422408 Lyophilized MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414704 Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422408 Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP319139 Recombinant protein of human KIAA0774 (KIAA0774), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products