OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAB1 (NM_002039) Human Mass Spec Standard

Be the first to review this product
SKU
PH319005
GAB1 MS Standard C13 and N15-labeled recombinant protein (NP_002030)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349521 Rabbit Polyclonal Anti-GAB1 Antibody
100 ul
$205.00
LY404056 Transient overexpression lysate of GRB2-associated binding protein 1 (GAB1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GAB1 or NM_002039"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219005
Predicted MW 76.4 kDa
Protein Sequence
Protein Sequence
>RC219005 representing NM_002039
Red=Cloning site Green=Tags(s)

MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDA
GLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPL
AINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDPQDYLLLINCQSKKPEPTRTHADSAKSTSSE
TDCNDNVPSHKNPASSQSKHGMNGFFQQQMIYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEA
DGELYVFNTPSGTSSVETQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHP
AHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVP
PPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARD
SSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDL
DLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002030
RefSeq Size 3323
RefSeq ORF 2082
Synonyms DFNB26
Locus ID 2549
UniProt ID Q13480
Cytogenetics 4q31.21
Summary The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Aug 2008
Protein Families Druggable Genome
Protein Pathways ErbB signaling pathway, Neurotrophin signaling pathway, Renal cell carcinoma
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAB1" proteins (7)
SKU Description Size Price
PH309622 GAB1 MS Standard C13 and N15-labeled recombinant protein (NP_997006) 10 ug
$3,360.00
LC400746 Lyophilized GAB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404056 Lyophilized GAB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400746 Transient overexpression lysate of GRB2-associated binding protein 1 (GAB1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY404056 Transient overexpression lysate of GRB2-associated binding protein 1 (GAB1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP309622 Recombinant protein of human GRB2-associated binding protein 1 (GAB1), transcript variant 1, 20 µg 20 ug
$867.00
TP319005 Recombinant protein of human GRB2-associated binding protein 1 (GAB1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products