GAB1 (NM_207123) Human Mass Spec Standard

SKU
PH309622
GAB1 MS Standard C13 and N15-labeled recombinant protein (NP_997006)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209622]
Predicted MW 80 kDa
Protein Sequence
Protein Sequence
>RC209622 protein sequence
Red=Cloning site Green=Tags(s)

MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDA
GLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPL
AINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDPQDYLLLINCQSKKPEPTRTHADSAKSTSSE
TDCNDNVPSHKNPASSQSKHGMNGFFQQQMIYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEA
DGELYVFNTPSGTSSVETQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHP
AHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVP
PPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKGQSPKILRLKPHGLERTDSQTIGDFATRRKVK
PAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED
PNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLAL
KSTREAWTDGRQSTESETPAKSVK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997006
RefSeq Size 7926
RefSeq ORF 2172
Synonyms DFNB26
Locus ID 2549
UniProt ID Q13480
Cytogenetics 4q31.21
Summary The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Protein Families Druggable Genome
Protein Pathways ErbB signaling pathway, Neurotrophin signaling pathway, Renal cell carcinoma
Write Your Own Review
You're reviewing:GAB1 (NM_207123) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319005 GAB1 MS Standard C13 and N15-labeled recombinant protein (NP_002030) 10 ug
$3,255.00
LC400746 GAB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404056 GAB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400746 Transient overexpression lysate of GRB2-associated binding protein 1 (GAB1), transcript variant 2 100 ug
$665.00
LY404056 Transient overexpression lysate of GRB2-associated binding protein 1 (GAB1), transcript variant 1 100 ug
$436.00
TP309622 Recombinant protein of human GRB2-associated binding protein 1 (GAB1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319005 Recombinant protein of human GRB2-associated binding protein 1 (GAB1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.