CMPK2 (NM_207315) Human Mass Spec Standard

CAT#: PH318794

CMPK2 MS Standard C13 and N15-labeled recombinant protein (NP_997198)

Product Images

Coomassie blue staining of purified CMPK2 protein (Cat# TP318794). The protein was produced from HEK293T cells transfected with CMPK2 cDNA clone (Cat# RC218794) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218794
• Predicted MW: 49.3 kDa
• Protein Sequence:
  Sequence Link

  >RC218794 representing NM_207315
  Red=Cloning site Green=Tags(s)
  
  MAFARRLLRGPLSGPLLGRRGVCAGAMAPPRRFVLELPDCTLAHFALGADAPGDADAPDPRLAALLGPPE
  RSYSLCVPVTPDAGCGARVRAARLHQRLLHQLRRGPFQRCQLLRLLCYCPGGQAGGAQQGFLLRDPLDDP
  DTRQALLELLGACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSS
  VVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKGKFQVVAIEGLDATGKTTVTQSVADSLKAVL
  LKSPPSCIGQWRKIFDDEPTIIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWHSTATYAIATEVSGGLQ
  HLPPAHHPVYQWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREEAELEANSVFRQKVEMSYQRMENP
  GCHVVDASPSREKVLQTVLSLIQNSFSEP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_997198
• RefSeq Size: 3009
• RefSeq ORF: 1347
• Synonyms: NDK; TMPK2; TYKi; UMP-CMPK2
• Locus ID: 129607
• UniProt ID: Q5EBM0
• Cytogenetics: 2p25.2
• Summary: This gene encodes one of the enzymes in the nucleotide synthesis salvage pathway that may participate in terminal differentiation of monocytic cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
• Protein Pathways: Metabolic pathways, Pyrimidine metabolism