OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CMPK2 (NM_207315) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318794
Recombinant protein of human cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial (CMPK2), nuclear gene encoding mitochondrial protein, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA320098 Rabbit Polyclonal CMPK2 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CMPK2 or NM_207315"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218794 representing NM_207315
Red=Cloning site Green=Tags(s)

MAFARRLLRGPLSGPLLGRRGVCAGAMAPPRRFVLELPDCTLAHFALGADAPGDADAPDPRLAALLGPPE
RSYSLCVPVTPDAGCGARVRAARLHQRLLHQLRRGPFQRCQLLRLLCYCPGGQAGGAQQGFLLRDPLDDP
DTRQALLELLGACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSS
VVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKGKFQVVAIEGLDATGKTTVTQSVADSLKAVL
LKSPPSCIGQWRKIFDDEPTIIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWHSTATYAIATEVSGGLQ
HLPPAHHPVYQWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREEAELEANSVFRQKVEMSYQRMENP
GCHVVDASPSREKVLQTVLSLIQNSFSEP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_997198
Locus ID 129607
UniProt ID Q5EBM0
Cytogenetics 2p25.2
RefSeq Size 3009
RefSeq ORF 1347
Synonyms NDK; TMPK2; TYKi; UMP-CMPK2
Summary This gene encodes one of the enzymes in the nucleotide synthesis salvage pathway that may participate in terminal differentiation of monocytic cells. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Feb 2012
Protein Categories Intracellular Proteins
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CMPK2" proteins (3)
SKU Description Size Price
PH318794 CMPK2 MS Standard C13 and N15-labeled recombinant protein (NP_997198) 10 ug
$3,360.00
LC404093 Lyophilized CMPK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404093 Transient overexpression lysate of cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial (CMPK2), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$665.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products